• China Buprofezin [69327-76-0] factory
    Name Buprofezin Molecular Formula C16H23N3OS Molecular Weight 305.44 CAS Registry Number 69327-76-0 diazthines insect growth regulators, belongs to insect molting inhibitors. By inhibiting the synthesis of chitosan and interfering with metabolism, the pest... more
    Place of Origin:China

    Buprofezin [69327-76-0]

  • China Raspberry ketone CAS No.: 84929-76-0 factory
    Raspberry ketone CAS No.: 84929-76-0 Appearance: white powder Variety: raspberry extract Extract Method: Water/ Grain Alcohol Specification:99% ABOUT Raspberry Ketones: ... more
    Brand Name:Chinafoodpharm
    Place of Origin:China
    Certification:GMP,ISO,HACCP

    Raspberry ketone CAS No.: 84929-76-0

  • China Arbutin;CAS NO.: 497-76-7;98% factory
    English name]: Arbutin [CAS NO.]: 497-76-7 [Formula]: C12H16O7 [Molecular Weight]: 272.25 [Structural Formula]: [Specification]: 98% [Test method]: HPLC [Product properties]: ... more
    Brand Name:Zhanjo
    Model Number:ZJ-257
    Place of Origin:China

    Arbutin;CAS NO.: 497-76-7;98%

  • China (CAS No.:82161-76-0)INDENYLZIRCONIUM(IV) TRICHLORIDE factory
    INDENYLZIRCONIUM(IV) TRICHLORIDE Product code:INDENYLZIRCONIUM(IV) TRICHLORIDE CAS No.:82161-76-0 Molecular formula: C9H7Cl3Zr Molecular Weight: 312.73 Materialized properties: Melting Point: 151-161°c In Stock : Available / Available on request Supply ... more
    Brand Name:Honorshine Chem
    Place of Origin:China WuXi
    Minimum Order Quantity:2KG

    (CAS No.:82161-76-0)INDENYLZIRCONIUM(IV) TRICHLORIDE

  • China CAS No. 497-76-7 Beta Arbutin with 99% Purity for Skin Whiten Cosmetic Products factory
    CAS No. 497-76-7 Beta Arbutin with 99% Purity for Skin Whiten Cosmetic Products Beyond Bionherbal is a professional manufacturer and supplier of Beta Arbutin. The appearance of Beta Arbutin is white crystal Powder and it is Easily soluble in hot water and ... more
    Brand Name:BBP
    Model Number:BBP-ARBUTIN-01
    Place of Origin:CHINA

    CAS No. 497-76-7 Beta Arbutin with 99% Purity for Skin Whiten Cosmetic Products

    Beyond Bioherbal Co.,ltd.
    [Shanghai,China]
  • China Olopatadine hydrochloride,Olopatadine( CAS NO.:140462-76-6) factory
    Name :Olopatadine hydrochloride Synonyms :(Z)-11-[3-(Dimethylamino)propylidene]-6,11-dihydrodibenz[b,e]oxepin-2-acetic acid hydrochloride Molecular Formula : C21H23NO3.HCl Molecular Weight :373.88 CAS NO.: 140462-76-6 more
    Brand Name:Olopatadine hydrochloride
    Model Number:CAS NO.:140462-76-6
    Place of Origin:.

    Olopatadine hydrochloride,Olopatadine( CAS NO.:140462-76-6)

  • China Exenatide Acetate Cas No:141732-76-5 factory
    Product Information Name:Exenatide Acetate, Exenatida Cas No:141732-76-5 Formula: C186H286N50O62S Molecular:4246.62 Sequence: HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS Purity:98% Appearance: white powder Source: synthetic Also know as AC 2993, Bydureon, ... more
    Brand Name:YS
    Model Number:YSCP
    Place of Origin:China

    Exenatide Acetate Cas No:141732-76-5

  • China Extracting agent TOA Trioctylamine factory price/Tri-octylamine Cas No.1116-76-3 Trioctylamine factory
    Trioctylamine CAS: 1116-76-3 Purity: 98% Min. Appearance: Colorless or yellowish transparent oily liquid Shu amine: 3.3% Min. Total amine: 3.4% Min. Acid value mgKOH/g: 128-142 Water content: 0.5% Max. Color APHA: 80 Max. Application: It can be used as ... more
    Brand Name:RARE
    Place of Origin:China

    Extracting agent TOA Trioctylamine factory price/Tri-octylamine Cas No.1116-76-3 Trioctylamine

  • China β - Arbutin CAS NO.497-76-7<cosmetic grade> factory
    Item Specification Results Appearance : White crystalline powder Assay: 99.7% Melting point: 198.5~201.5℃ Clarity of water solution: Transparency, colorless pH value of 1% aqueous solution: 5.0~7.0 Specific optical rotation 【α】 D 20 =-66±2º : -65.3 Arsenic... more
    Brand Name:close
    Model Number:SCE-C06
    Place of Origin:china mainland

    β - Arbutin CAS NO.497-76-7

    SUN CHEM ENTERPRISE CO., LTD
    [Zhejiang,China]
  • China Ci Pigment Red 170 Cas 2786-76-7 Plastic Rubber Pigment Ink Paint Chemical Pigment factory
    ... Moisture 1.0% max Residue passing through (80 mesh) 5.0% max Soluble matter in water 1.5% max Conductivity 500 max Application of CAS NO.2786-76-7 Pigment red 170 : Main Application: Air Drying Paint, Offset Ink Can Use: Industrial Paint, more
    Brand Name:Chemfine
    Model Number:Pigment red 170
    Place of Origin:Zhejiang, China

    Ci Pigment Red 170 Cas 2786-76-7 Plastic Rubber Pigment Ink Paint Chemical Pigment

  • China MEHQ Organic Reaction Intermediates 150-76-5 CAS , 4 Methoxyphenol For Pastic factory
    ... power Assay: 99% min Product name: 4-Methoxyphenol Molecular formula : C7H8O2 CAS NO. : 150-76-5 Molecular weight: 124.14 Quality Index : Appearance white crystal Melting point 54.0~56.5℃ Assay≥ 99.5% ... more
    Brand Name:AJA
    Place of Origin:Anhui China
    Minimum Order Quantity:25KG

    MEHQ Organic Reaction Intermediates 150-76-5 CAS , 4 Methoxyphenol For Pastic

  • China 99% Purity CAS 25547-51-7 BMK Glycidic Acid White Powder Manufacturer Supply factory
    Main Products BMK PMK CAS 20320-59-6 BMK oil CAS 5413-05-8 BMK powder CAS 5449-12-7 BMK Glycidic Acid CAS 28578-16-7 PMK ethyl glycidate oil/powder Bromine CAS 1451-82-7 2-bromo-4-methylpropiophenone CAS 1451-83-8 2-bromo-3-methylpropiophenone CAS 236117-... more
    Brand Name:CHUYAN
    Model Number:CAS 25547-51-7
    Place of Origin:China

    99% Purity CAS 25547-51-7 BMK Glycidic Acid White Powder Manufacturer Supply

  • China APIs Intermediates Ubenimex  APIs Intermediates CAS 58970-76-6 White Powder 99% factory
    Ubenimex CAS No 58970-76-6 for APIs Intermediates White Powder Purity 99% Name: Ubenimex CAS No: 58970-76-6 M.W: 308.37 Appearance: White powder Purity: 99% Product No: AK0001 Synonyms: NK 421; NSC 265489; N-[(2S,... more
    Brand Name:AK BIOTECH
    Model Number:58970-76-6
    Place of Origin:CHINA

    APIs Intermediates Ubenimex APIs Intermediates CAS 58970-76-6 White Powder 99%

    AK Biotech Co.,Ltd
    [Sichuan]
  • China Solenoid Valve Plunger Pulse Jet Valves WATSON WPS-CA/EP WPS-CA/TG WPS-CA/TD factory
    Solenoid Valve Plunger WATSON WPS-CA/EP WPS-CA/TG WPS-CA/TD Pulse Jet Valve Technical Specifications: (1). Working Pressure: 4-6 bar; (2). Working medium: clean air (3). Power supply: DC24V (AC220V/50Hz- 240V/60Hz) (4). Class of protection: IP65; (5). ... more
    Brand Name:WATSON
    Model Number:WPS-CA Plunger
    Place of Origin:China

    Solenoid Valve Plunger Pulse Jet Valves WATSON WPS-CA/EP WPS-CA/TG WPS-CA/TD

  • China CAS 501-30-4 Cosmetic Ingredients 99% Kojic Acid Skin Whitening factory
    Cometic Ingredient CAS 497-76-7 Skin Whitening Kojic Acid What’s Kojic Acid? Product Name Beta Arbutin Appearance White powder CAS NO 497-76-7 Certificate ISO9001,SGS,HALAL,KOSHER Function Skin Whitening Kojic acid is a kind of specialized inhibitor for ... more
    Brand Name:Ceres
    Model Number:Kojic Acid
    Place of Origin:Shaanxi, China

    CAS 501-30-4 Cosmetic Ingredients 99% Kojic Acid Skin Whitening

  • China KINGLONG 55-YEAR History Yellow Color Hand-operated Chain Block 1T*3M HSZ-CA factory
    CHONGQING KINGLONG MACHINERY CO., LTD 55 YEARS HISTORY Yellow Color Hand-operated Lifting Chain Block HSZ-CA 1T*3M About Chain Hoist 1 Ton 1 Ton small lifting chain block HSZ-CA is most popular model in the market of both nation-wide and overseas, with ... more
    Brand Name:Shuangyan
    Model Number:HSZ-CA
    Place of Origin:Chongqing, China

    KINGLONG 55-YEAR History Yellow Color Hand-operated Chain Block 1T*3M HSZ-CA

  • China 12V,10T,1.4KW Excavator Starter CAS-E Motor CAS-E 1835C Skid Steer 1959930C1 factory
    12V,10T,1.4KW Excavator Starter CAS-E Motor CAS-E 1835C Skid steer 1959930C1 Product Details Dear my friend, our company has thousands of products, and we cannot display them all at the moment. If you need to leave a message or send an email to us, we wil... more
    Brand Name:Senlong-MOTOR
    Model Number:CAS-E Motor
    Place of Origin:Guangzhou China

    12V,10T,1.4KW Excavator Starter CAS-E Motor CAS-E 1835C Skid Steer 1959930C1

  • China BDO 99.9% Transparent liquid 1,4-Butanediol CAS 110-63-4 First-class quality factory
    BDO 99.9% Transparent liquid 1,4-Butanediol CAS 110-63-4 First-class quality 1,4-Butanediol CAS 110-63-4 1, is a colorless, viscous liquid that reacts with strong oxidants. It is an important basic organic chemical raw material, used as solvent, non-toxic ... more
    Brand Name:Aweier
    Model Number:110-63-4
    Place of Origin:China

    BDO 99.9% Transparent liquid 1,4-Butanediol CAS 110-63-4 First-class quality

  • China 101-090-013 Photocell,with 4 polig JST plug,Cas For DT Xls50 Spreader  Parts factory
    Sy51 Sy101 Spreader Parts 101-090-013 Photocell,with 4 polig JST plug,CAS For DT Gerber Cutter Spare Parts Product Describtion of Photocell,with 4 polig JST plug,CAS Product Name Photocell,with 4 polig JST plug,CAS Part Number Brand DT-PARTS Part ... more
    Brand Name:DT-PARTS
    Model Number:101-090-013
    Place of Origin:China(Mainland)

    101-090-013 Photocell,with 4 polig JST plug,Cas For DT Xls50 Spreader Parts

  • China Acid Resistance UV Pigment Powder CAS No. 2786 76 7 For Automotive Paint factory
    Organic Pigment Powder Used For Coating Pigment, Ink Pigments, Plastic Rubber Pigment, Automotive Paint 1. Product Name Trade Name: Fast Red F5RK C.I. Number: Pigment Red 170 CAS Number: 2786-76-7 EU Number: 220-509-3 Chamical Family: Mono azo 2. Physical... more
    Brand Name:SKYHIL
    Model Number:Red 8
    Place of Origin:China

    Acid Resistance UV Pigment Powder CAS No. 2786 76 7 For Automotive Paint

Tell “cas no 69327 76 0” Suppliers Your Requirement
*E-mail:
* Message:
Characters Remaining: (0/3000)
Inquiry Cart 0