-
Name Buprofezin Molecular Formula C16H23N3OS Molecular Weight 305.44 CAS Registry Number 69327-76-0 diazthines insect growth regulators, belongs to insect molting inhibitors. By inhibiting the synthesis of chitosan and interfering with metabolism, the pest...
Name Buprofezin Molecular Formula C16H23N3OS Molecular Weight 305.44 CAS Registry Number 69327-76-0 diazthines insect growth regulators, belongs to insect molting inhibitors. By inhibiting the synthesis of chitosan and interfering with metabolism, the pest... more
Place of Origin:China
-
Raspberry ketone CAS No.: 84929-76-0 Appearance: white powder Variety: raspberry extract Extract Method: Water/ Grain Alcohol Specification:99% ABOUT Raspberry Ketones: ...
Raspberry ketone CAS No.: 84929-76-0 Appearance: white powder Variety: raspberry extract Extract Method: Water/ Grain Alcohol Specification:99% ABOUT Raspberry Ketones: ... more
Brand Name:Chinafoodpharm
Place of Origin:China
Certification:GMP,ISO,HACCP
Raspberry ketone CAS No.: 84929-76-0
-
English name]: Arbutin [CAS NO.]: 497-76-7 [Formula]: C12H16O7 [Molecular Weight]: 272.25 [Structural Formula]: [Specification]: 98% [Test method]: HPLC [Product properties]: ...
English name]: Arbutin [CAS NO.]: 497-76-7 [Formula]: C12H16O7 [Molecular Weight]: 272.25 [Structural Formula]: [Specification]: 98% [Test method]: HPLC [Product properties]: ... more
Brand Name:Zhanjo
Model Number:ZJ-257
Place of Origin:China
Arbutin;CAS NO.: 497-76-7;98%
-
INDENYLZIRCONIUM(IV) TRICHLORIDE Product code:INDENYLZIRCONIUM(IV) TRICHLORIDE CAS No.:82161-76-0 Molecular formula: C9H7Cl3Zr Molecular Weight: 312.73 Materialized properties: Melting Point: 151-161°c In Stock : Available / Available on request Supply ...
INDENYLZIRCONIUM(IV) TRICHLORIDE Product code:INDENYLZIRCONIUM(IV) TRICHLORIDE CAS No.:82161-76-0 Molecular formula: C9H7Cl3Zr Molecular Weight: 312.73 Materialized properties: Melting Point: 151-161°c In Stock : Available / Available on request Supply ... more
Brand Name:Honorshine Chem
Place of Origin:China WuXi
Minimum Order Quantity:2KG
(CAS No.:82161-76-0)INDENYLZIRCONIUM(IV) TRICHLORIDE
-
CAS No. 497-76-7 Beta Arbutin with 99% Purity for Skin Whiten Cosmetic Products Beyond Bionherbal is a professional manufacturer and supplier of Beta Arbutin. The appearance of Beta Arbutin is white crystal Powder and it is Easily soluble in hot water and ...
-
Name :Olopatadine hydrochloride Synonyms :(Z)-11-[3-(Dimethylamino)propylidene]-6,11-dihydrodibenz[b,e]oxepin-2-acetic acid hydrochloride Molecular Formula : C21H23NO3.HCl Molecular Weight :373.88 CAS NO.: 140462-76-6
Name :Olopatadine hydrochloride Synonyms :(Z)-11-[3-(Dimethylamino)propylidene]-6,11-dihydrodibenz[b,e]oxepin-2-acetic acid hydrochloride Molecular Formula : C21H23NO3.HCl Molecular Weight :373.88 CAS NO.: 140462-76-6 more
Brand Name:Olopatadine hydrochloride
Model Number:CAS NO.:140462-76-6
Place of Origin:.
Olopatadine hydrochloride,Olopatadine( CAS NO.:140462-76-6)
-
Product Information Name:Exenatide Acetate, Exenatida Cas No:141732-76-5 Formula: C186H286N50O62S Molecular:4246.62 Sequence: HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS Purity:98% Appearance: white powder Source: synthetic Also know as AC 2993, Bydureon, ...
Product Information Name:Exenatide Acetate, Exenatida Cas No:141732-76-5 Formula: C186H286N50O62S Molecular:4246.62 Sequence: HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS Purity:98% Appearance: white powder Source: synthetic Also know as AC 2993, Bydureon, ... more
Brand Name:YS
Model Number:YSCP
Place of Origin:China
Exenatide Acetate Cas No:141732-76-5
-
Trioctylamine CAS: 1116-76-3 Purity: 98% Min. Appearance: Colorless or yellowish transparent oily liquid Shu amine: 3.3% Min. Total amine: 3.4% Min. Acid value mgKOH/g: 128-142 Water content: 0.5% Max. Color APHA: 80 Max. Application: It can be used as ...
-
Item Specification Results Appearance : White crystalline powder Assay: 99.7% Melting point: 198.5~201.5℃ Clarity of water solution: Transparency, colorless pH value of 1% aqueous solution: 5.0~7.0 Specific optical rotation 【α】 D 20 =-66±2º : -65.3 Arsenic...
Item Specification Results Appearance : White crystalline powder Assay: 99.7% Melting point: 198.5~201.5℃ Clarity of water solution: Transparency, colorless pH value of 1% aqueous solution: 5.0~7.0 Specific optical rotation 【α】 D 20 =-66±2º : -65.3 Arsenic... more
Brand Name:close
Model Number:SCE-C06
Place of Origin:china mainland
β - Arbutin CAS NO.497-76-7
-
... Moisture 1.0% max Residue passing through (80 mesh) 5.0% max Soluble matter in water 1.5% max Conductivity 500 max Application of CAS NO.2786-76-7 Pigment red 170 : Main Application: Air Drying Paint, Offset Ink Can Use: Industrial Paint,
-
... power Assay: 99% min Product name: 4-Methoxyphenol Molecular formula : C7H8O2 CAS NO. : 150-76-5 Molecular weight: 124.14 Quality Index : Appearance white crystal Melting point 54.0~56.5℃ Assay≥ 99.5% ...
-
Main Products BMK PMK CAS 20320-59-6 BMK oil CAS 5413-05-8 BMK powder CAS 5449-12-7 BMK Glycidic Acid CAS 28578-16-7 PMK ethyl glycidate oil/powder Bromine CAS 1451-82-7 2-bromo-4-methylpropiophenone CAS 1451-83-8 2-bromo-3-methylpropiophenone CAS 236117-...
Main Products BMK PMK CAS 20320-59-6 BMK oil CAS 5413-05-8 BMK powder CAS 5449-12-7 BMK Glycidic Acid CAS 28578-16-7 PMK ethyl glycidate oil/powder Bromine CAS 1451-82-7 2-bromo-4-methylpropiophenone CAS 1451-83-8 2-bromo-3-methylpropiophenone CAS 236117-... more
Brand Name:CHUYAN
Model Number:CAS 25547-51-7
Place of Origin:China
99% Purity CAS 25547-51-7 BMK Glycidic Acid White Powder Manufacturer Supply
-
Ubenimex CAS No 58970-76-6 for APIs Intermediates White Powder Purity 99% Name: Ubenimex CAS No: 58970-76-6 M.W: 308.37 Appearance: White powder Purity: 99% Product No: AK0001 Synonyms: NK 421; NSC 265489; N-[(2S,...
-
Solenoid Valve Plunger WATSON WPS-CA/EP WPS-CA/TG WPS-CA/TD Pulse Jet Valve Technical Specifications: (1). Working Pressure: 4-6 bar; (2). Working medium: clean air (3). Power supply: DC24V (AC220V/50Hz- 240V/60Hz) (4). Class of protection: IP65; (5). ...
Solenoid Valve Plunger WATSON WPS-CA/EP WPS-CA/TG WPS-CA/TD Pulse Jet Valve Technical Specifications: (1). Working Pressure: 4-6 bar; (2). Working medium: clean air (3). Power supply: DC24V (AC220V/50Hz- 240V/60Hz) (4). Class of protection: IP65; (5). ... more
Brand Name:WATSON
Model Number:WPS-CA Plunger
Place of Origin:China
Solenoid Valve Plunger Pulse Jet Valves WATSON WPS-CA/EP WPS-CA/TG WPS-CA/TD
-
Cometic Ingredient CAS 497-76-7 Skin Whitening Kojic Acid What’s Kojic Acid? Product Name Beta Arbutin Appearance White powder CAS NO 497-76-7 Certificate ISO9001,SGS,HALAL,KOSHER Function Skin Whitening Kojic acid is a kind of specialized inhibitor for ...
Cometic Ingredient CAS 497-76-7 Skin Whitening Kojic Acid What’s Kojic Acid? Product Name Beta Arbutin Appearance White powder CAS NO 497-76-7 Certificate ISO9001,SGS,HALAL,KOSHER Function Skin Whitening Kojic acid is a kind of specialized inhibitor for ... more
Brand Name:Ceres
Model Number:Kojic Acid
Place of Origin:Shaanxi, China
CAS 501-30-4 Cosmetic Ingredients 99% Kojic Acid Skin Whitening
-
CHONGQING KINGLONG MACHINERY CO., LTD 55 YEARS HISTORY Yellow Color Hand-operated Lifting Chain Block HSZ-CA 1T*3M About Chain Hoist 1 Ton 1 Ton small lifting chain block HSZ-CA is most popular model in the market of both nation-wide and overseas, with ...
CHONGQING KINGLONG MACHINERY CO., LTD 55 YEARS HISTORY Yellow Color Hand-operated Lifting Chain Block HSZ-CA 1T*3M About Chain Hoist 1 Ton 1 Ton small lifting chain block HSZ-CA is most popular model in the market of both nation-wide and overseas, with ... more
Brand Name:Shuangyan
Model Number:HSZ-CA
Place of Origin:Chongqing, China
KINGLONG 55-YEAR History Yellow Color Hand-operated Chain Block 1T*3M HSZ-CA
-
12V,10T,1.4KW Excavator Starter CAS-E Motor CAS-E 1835C Skid steer 1959930C1 Product Details Dear my friend, our company has thousands of products, and we cannot display them all at the moment. If you need to leave a message or send an email to us, we wil...
12V,10T,1.4KW Excavator Starter CAS-E Motor CAS-E 1835C Skid steer 1959930C1 Product Details Dear my friend, our company has thousands of products, and we cannot display them all at the moment. If you need to leave a message or send an email to us, we wil... more
Brand Name:Senlong-MOTOR
Model Number:CAS-E Motor
Place of Origin:Guangzhou China
12V,10T,1.4KW Excavator Starter CAS-E Motor CAS-E 1835C Skid Steer 1959930C1
-
BDO 99.9% Transparent liquid 1,4-Butanediol CAS 110-63-4 First-class quality 1,4-Butanediol CAS 110-63-4 1, is a colorless, viscous liquid that reacts with strong oxidants. It is an important basic organic chemical raw material, used as solvent, non-toxic ...
BDO 99.9% Transparent liquid 1,4-Butanediol CAS 110-63-4 First-class quality 1,4-Butanediol CAS 110-63-4 1, is a colorless, viscous liquid that reacts with strong oxidants. It is an important basic organic chemical raw material, used as solvent, non-toxic ... more
Brand Name:Aweier
Model Number:110-63-4
Place of Origin:China
BDO 99.9% Transparent liquid 1,4-Butanediol CAS 110-63-4 First-class quality
-
Sy51 Sy101 Spreader Parts 101-090-013 Photocell,with 4 polig JST plug,CAS For DT Gerber Cutter Spare Parts Product Describtion of Photocell,with 4 polig JST plug,CAS Product Name Photocell,with 4 polig JST plug,CAS Part Number Brand DT-PARTS Part ...
Sy51 Sy101 Spreader Parts 101-090-013 Photocell,with 4 polig JST plug,CAS For DT Gerber Cutter Spare Parts Product Describtion of Photocell,with 4 polig JST plug,CAS Product Name Photocell,with 4 polig JST plug,CAS Part Number Brand DT-PARTS Part ... more
Brand Name:DT-PARTS
Model Number:101-090-013
Place of Origin:China(Mainland)
101-090-013 Photocell,with 4 polig JST plug,Cas For DT Xls50 Spreader Parts
-
Organic Pigment Powder Used For Coating Pigment, Ink Pigments, Plastic Rubber Pigment, Automotive Paint 1. Product Name Trade Name: Fast Red F5RK C.I. Number: Pigment Red 170 CAS Number: 2786-76-7 EU Number: 220-509-3 Chamical Family: Mono azo 2. Physical...
Organic Pigment Powder Used For Coating Pigment, Ink Pigments, Plastic Rubber Pigment, Automotive Paint 1. Product Name Trade Name: Fast Red F5RK C.I. Number: Pigment Red 170 CAS Number: 2786-76-7 EU Number: 220-509-3 Chamical Family: Mono azo 2. Physical... more
Brand Name:SKYHIL
Model Number:Red 8
Place of Origin:China
Acid Resistance UV Pigment Powder CAS No. 2786 76 7 For Automotive Paint